Lineage for d1agea2 (1age A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937871Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 2937875Domain d1agea2: 1age A:1-181 [38264]
    Other proteins in same PDB: d1agea1, d1ageb_
    mutant

Details for d1agea2

PDB Entry: 1age (more details), 2.3 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyrl-7r mutation)
PDB Compounds: (A:) b*0801

SCOPe Domain Sequences for d1agea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOPe Domain Coordinates for d1agea2:

Click to download the PDB-style file with coordinates for d1agea2.
(The format of our PDB-style files is described here.)

Timeline for d1agea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ageb_