Lineage for d6ll8a_ (6ll8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919431Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 2919432Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 2919467Family c.107.1.0: automated matches [191432] (1 protein)
    not a true family
  6. 2919468Protein automated matches [190622] (2 species)
    not a true protein
  7. 2919472Species Shewanella sp. [TaxId:912551] [382630] (2 PDB entries)
  8. 2919473Domain d6ll8a_: 6ll8 A: [382631]
    automated match to d1k23a_
    complexed with 2pn, ca, epe, f, gol, mg

Details for d6ll8a_

PDB Entry: 6ll8 (more details), 1.3 Å

PDB Description: type ii inorganic pyrophosphatase (ppase) from the psychrophilic bacterium shewanella sp. as-11, mg-pnp form
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6ll8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ll8a_ c.107.1.0 (A:) automated matches {Shewanella sp. [TaxId: 912551]}
smyvvghkipdsdsicgaialaylknqigepaiaarlgelspetafilekfgfeapeykt
syageevyivdhseitqapddiaqativgivdhhklgdlttstplecwirpvgcsntvik
mmydfyqvkipaniagimmcailsdtvifksptcttadircvealaeiagvedfkevgmd
mfkvksavegtpardlvmrdfkdfnmngnlvgigqlevidlavfddikadleadiaklkv
egnrhsvlllltdimkegsemlvvsdsadlteraygkptvdgrvwldgvlsrkkqvvpal
qdafqk

SCOPe Domain Coordinates for d6ll8a_:

Click to download the PDB-style file with coordinates for d6ll8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ll8a_: