SCOPe 2.07: Domain d6lkra1: 6lkr A:78-207

Lineage for d6lkra1 (6lkr A:78-207)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)

8. Domain d6lkra1: 6lkr A:78-207 [382627]
   Other proteins in same PDB: d6lkra2, d6lkrb2
   automated match to d1ypof_
   complexed with b3p, ca

Details for d6lkra1

PDB Entry: 6lkr, 1.84 Å

PDB Description: crystal structure of mouse dcar2 crd domain complex

PDB Compounds: (A:) C-type lectin domain family 4, member b1

SCOPe Domain Sequences for d6lkra1:

Sequence; same for both SEQRES and ATOM records:

>d6lkra1 d.169.1.0 (A:78-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildihaay
figlwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscnlk
qksvcqmkki

Timeline for d6lkra1:

• d6lkra1 is new in SCOPe 2.07-stable