SCOP 1.67: Domain d1agfa2: 1agf A:1-181

Lineage for d1agfa2 (1agf A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)

8. Domain d1agfa2: 1agf A:1-181 [38262]
   Other proteins in same PDB: d1agfa1, d1agfb_
   mutant

Details for d1agfa2

PDB Entry: 1agf, 2.2 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkrykl-5r mutation)

SCOP Domain Sequences for d1agfa2:

Sequence; same for both SEQRES and ATOM records:

>d1agfa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Timeline for d1agfa2:

• d1agfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1agfa2 appears in SCOP 1.65
  
• d1agfa2 appears in SCOP 1.69
  
• d1agfa2 appears in the current release, SCOPe 2.08