Lineage for d6lfja1 (6lfj A:78-207)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 3082550Domain d6lfja1: 6lfj A:78-207 [382612]
    Other proteins in same PDB: d6lfja2, d6lfjb2
    automated match to d1ypof_
    complexed with b3p, ca, ipd, man

Details for d6lfja1

PDB Entry: 6lfj (more details), 1.84 Å

PDB Description: crystal structure of mouse dcar2 crd domain complex with ipm2
PDB Compounds: (A:) C-type lectin domain family 4, member b1

SCOPe Domain Sequences for d6lfja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lfja1 d.169.1.0 (A:78-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildihaay
figlwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscnlk
qksvcqmkki

SCOPe Domain Coordinates for d6lfja1:

Click to download the PDB-style file with coordinates for d6lfja1.
(The format of our PDB-style files is described here.)

Timeline for d6lfja1:

  • d6lfja1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6lfja2