Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d6kzra1: 6kzr A:78-207 [382610] Other proteins in same PDB: d6kzra2, d6kzrb2 automated match to d1ypof_ complexed with ca, gol |
PDB Entry: 6kzr (more details), 2.3 Å
SCOPe Domain Sequences for d6kzra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kzra1 d.169.1.0 (A:78-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildihaay figlwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscnlk qksvcqmkki
Timeline for d6kzra1: