SCOPe 2.08: Domain d6joub_: 6jou B:

Lineage for d6joub_ (6jou B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)

8. Domain d6joub_: 6jou B: [382605]
   Other proteins in same PDB: d6jouc_, d6joud_, d6joug_, d6jouh_
   automated match to d1kx5b_
   protein/DNA complex; complexed with mn

Details for d6joub_

PDB Entry: 6jou, 2.17 Å

PDB Description: crystal structure of the human nucleosome containing h2a.z.1 s42r

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d6joub_:

Sequence; same for both SEQRES and ATOM records:

>d6joub_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfg

Timeline for d6joub_:

• d6joub_ first appeared in SCOPe 2.07