Lineage for d1agda2 (1agd A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856464Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 856465Domain d1agda2: 1agd A:1-181 [38260]
    Other proteins in same PDB: d1agda1, d1agdb_

Details for d1agda2

PDB Entry: 1agd (more details), 2.05 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkykl-index peptide)
PDB Compounds: (A:) b*0801

SCOP Domain Sequences for d1agda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agda2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

SCOP Domain Coordinates for d1agda2:

Click to download the PDB-style file with coordinates for d1agda2.
(The format of our PDB-style files is described here.)

Timeline for d1agda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1agdb_