SCOP 1.71: Domain d2hlaa2: 2hla A:1-181

Lineage for d2hlaa2 (2hla A:1-181)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)

8. Domain d2hlaa2: 2hla A:1-181 [38259]
   Other proteins in same PDB: d2hlaa1, d2hlab_

Details for d2hlaa2

PDB Entry: 2hla, 2.6 Å

PDB Description: specificity pockets for the side chains of peptide antigens in hla- aw68

SCOP Domain Sequences for d2hlaa2:

Sequence; same for both SEQRES and ATOM records:

>d2hlaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

Timeline for d2hlaa2:

• d2hlaa2 first appeared (with stable ids) in SCOP 1.55
  
• d2hlaa2 appears in SCOP 1.69
  
• d2hlaa2 appears in SCOP 1.73
  
• d2hlaa2 appears in the current release, SCOPe 2.08