![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries) |
![]() | Domain d6jkbb1: 6jkb B:2-244 [382584] Other proteins in same PDB: d6jkba2, d6jkbb2 automated match to d4eyba_ complexed with zn, zz7 |
PDB Entry: 6jkb (more details), 2.44 Å
SCOPe Domain Sequences for d6jkbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jkbb1 d.157.1.0 (B:2-244) automated matches {Klebsiella pneumoniae [TaxId: 573]} pgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad klr
Timeline for d6jkbb1: