SCOPe 2.08: Domain d6jkbb1: 6jkb B:2-244

Lineage for d6jkbb1 (6jkb B:2-244)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d6jkbb1: 6jkb B:2-244 [382584]
   Other proteins in same PDB: d6jkba2, d6jkbb2
   automated match to d4eyba_
   complexed with zn, zz7

Details for d6jkbb1

PDB Entry: 6jkb, 2.44 Å

PDB Description: crystal structure of metallo-beta-lactamse, ndm-1, in complex with hydrolyzed ampicillin

PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6jkbb1:

Sequence; same for both SEQRES and ATOM records:

>d6jkbb1 d.157.1.0 (B:2-244) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
klr

Timeline for d6jkbb1:

• d6jkbb1 first appeared in SCOPe 2.07