Lineage for d6jkbb1 (6jkb B:2-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997710Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2997880Domain d6jkbb1: 6jkb B:2-244 [382584]
    Other proteins in same PDB: d6jkba2, d6jkbb2
    automated match to d4eyba_
    complexed with zn, zz7

Details for d6jkbb1

PDB Entry: 6jkb (more details), 2.44 Å

PDB Description: crystal structure of metallo-beta-lactamse, ndm-1, in complex with hydrolyzed ampicillin
PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6jkbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jkbb1 d.157.1.0 (B:2-244) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
klr

SCOPe Domain Coordinates for d6jkbb1:

Click to download the PDB-style file with coordinates for d6jkbb1.
(The format of our PDB-style files is described here.)

Timeline for d6jkbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jkbb2