Lineage for d6jouc_ (6jou C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312588Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2312589Protein automated matches [238450] (4 species)
    not a true protein
  7. 2312599Species Human (Homo sapiens) [TaxId:9606] [238452] (7 PDB entries)
  8. 2312600Domain d6jouc_: 6jou C: [382582]
    Other proteins in same PDB: d6joub_, d6joud_, d6jouf_, d6jouh_
    automated match to d1id3c_
    protein/DNA complex; complexed with mn

Details for d6jouc_

PDB Entry: 6jou (more details), 2.17 Å

PDB Description: crystal structure of the human nucleosome containing h2a.z.1 s42r
PDB Compounds: (C:) histone h2a.z

SCOPe Domain Sequences for d6jouc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jouc_ a.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkavsrsqraglqfpvgrihrhlksrttrhgrvgataavysaaileyltaevlelagnas
kdlkvkritprhlqlairgdeeldslikatiagggviphihkslig

SCOPe Domain Coordinates for d6jouc_:

Click to download the PDB-style file with coordinates for d6jouc_.
(The format of our PDB-style files is described here.)

Timeline for d6jouc_: