Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.0: automated matches [238448] (1 protein) not a true family |
Protein automated matches [238450] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [238452] (7 PDB entries) |
Domain d6jouc_: 6jou C: [382582] Other proteins in same PDB: d6joub_, d6joud_, d6jouf_, d6jouh_ automated match to d1id3c_ protein/DNA complex; complexed with mn |
PDB Entry: 6jou (more details), 2.17 Å
SCOPe Domain Sequences for d6jouc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jouc_ a.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tkavsrsqraglqfpvgrihrhlksrttrhgrvgataavysaaileyltaevlelagnas kdlkvkritprhlqlairgdeeldslikatiagggviphihkslig
Timeline for d6jouc_: