SCOP 1.63: Domain d1tmca_: 1tmc A:

Lineage for d1tmca_ (1tmc A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (3 PDB entries)

8. Domain d1tmca_: 1tmc A: [38258]
   Other proteins in same PDB: d1tmcb_

Details for d1tmca_

PDB Entry: 1tmc, 2.3 Å

PDB Description: the three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain

SCOP Domain Sequences for d1tmca_:

Sequence; same for both SEQRES and ATOM records:

>d1tmca_ d.19.1.1 (A:) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrryleng

Timeline for d1tmca_:

• d1tmca_ first appeared (with stable ids) in SCOP 1.55
  
• d1tmca_ appears in SCOP 1.61
  
• d1tmca_ appears in SCOP 1.65
  
• d1tmca_ appears in the current release, SCOPe 2.08