Lineage for d6hj2a_ (6hj2 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Pregnane x receptor, PXR [63624] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63625] (31 PDB entries)
  8. Domain d6hj2a_: 6hj2 A: [382564]
    automated match to d1m13a_
    complexed with ipa, p06

Details for d6hj2a_

PDB Entry: 6hj2 (more details), 2.2800000000000002 Å

PDB Description: crystal structure of hpxr in complex with dabrafenib
PDB Compounds: (A:) Nuclear receptor subfamily 1 group I member 2

SCOPe Domain Sequences for d6hj2a_:

Sequence, based on SEQRES records: (download)

>d6hj2a_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
vqglteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapreeaakws
qvrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakv
isyfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlll
epmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecn
rpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgitgs

Sequence, based on observed residues (ATOM records): (download)

>d6hj2a_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
vqglteeqrmmirelmdaqmktfdttfshfknfrlpgvaakwsqvrkdlcslkvslqlrg
edgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllk
gaafelcqlrfntvfnaetgtwecgrlsycledtfqqlllepmlkfhymlkklqlheeey
vlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltel
rsinaqhtqrllriqdihpfatplmqelfgitgs

SCOPe Domain Coordinates for d6hj2a_ are not available.

Timeline for d6hj2a_: