Lineage for d1hsad2 (1hsa D:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198173Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries)
    Uniprot P03989 25-300
  8. 1198182Domain d1hsad2: 1hsa D:1-181 [38256]
    Other proteins in same PDB: d1hsaa1, d1hsab_, d1hsad1, d1hsae_

Details for d1hsad2

PDB Entry: 1hsa (more details), 2.1 Å

PDB Description: the three-dimensional structure of hla-b27 at 2.1 angstroms resolution suggests a general mechanism for tight peptide binding to mhc
PDB Compounds: (D:) class I histocompatibility antigen (hla-b*2705)

SCOPe Domain Sequences for d1hsad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsad2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d1hsad2:

Click to download the PDB-style file with coordinates for d1hsad2.
(The format of our PDB-style files is described here.)

Timeline for d1hsad2: