Lineage for d1hhha2 (1hhh A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600266Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (36 PDB entries)
  8. 600320Domain d1hhha2: 1hhh A:1-181 [38252]
    Other proteins in same PDB: d1hhha1, d1hhhb_

Details for d1hhha2

PDB Entry: 1hhh (more details), 3 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhha2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hhha2:

Click to download the PDB-style file with coordinates for d1hhha2.
(The format of our PDB-style files is described here.)

Timeline for d1hhha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hhha1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hhhb_