SCOPe 2.08: Domain d6uhla_: 6uhl A:

Lineage for d6uhla_ (6uhl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)

8. Domain d6uhla_: 6uhl A: [382514]
   automated match to d3srya_
   complexed with unl

Details for d6uhla_

PDB Entry: 6uhl, 1.91 Å

PDB Description: crystal structure of c148 mgfp-scdna-1

PDB Compounds: (A:) C148 mGFP-scDNA-1

SCOPe Domain Sequences for d6uhla_:

Sequence; same for both SEQRES and ATOM records:

>d6uhla_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfilttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynchnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d6uhla_:

• d6uhla_ first appeared in SCOPe 2.07