Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
Domain d6xv0a3: 6xv0 A:389-583 [382504] automated match to d1n5ua3 complexed with m6o, myr |
PDB Entry: 6xv0 (more details), 3 Å
SCOPe Domain Sequences for d6xv0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xv0a3 a.126.1.0 (A:389-583) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf aeegkklvaasqaal
Timeline for d6xv0a3: