SCOPe 2.02: Domain d1qsea2: 1qse A:1-181

Lineage for d1qsea2 (1qse A:1-181)

Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
Uniprot P01892 25-298
Domain d1qsea2: 1qse A:1-181 [38250]
Other proteins in same PDB: d1qsea1, d1qseb_, d1qsed1, d1qsed2, d1qsee1, d1qsee2

Details for d1qsea2

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

PDB Compounds: (A:) PROTEIN (MHC class I HLA-A)

SCOPe Domain Sequences for d1qsea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1qsea2:

Click to download the PDB-style file with coordinates for d1qsea2.
(The format of our PDB-style files is described here.)

Timeline for d1qsea2: