Lineage for d1qsea2 (1qse A:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31188Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (20 PDB entries)
  8. 31215Domain d1qsea2: 1qse A:1-181 [38250]
    Other proteins in same PDB: d1qsea1, d1qseb1, d1qsed1, d1qsed2, d1qsee1, d1qsee2

Details for d1qsea2

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide v7r

SCOP Domain Sequences for d1qsea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsea2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1qsea2:

Click to download the PDB-style file with coordinates for d1qsea2.
(The format of our PDB-style files is described here.)

Timeline for d1qsea2: