SCOPe 2.08: Domain d6uhnb_: 6uhn B:

Lineage for d6uhnb_ (6uhn B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)

8. Domain d6uhnb_: 6uhn B: [382471]
   automated match to d3srya_
   complexed with unl

Details for d6uhnb_

PDB Entry: 6uhn, 1.92 Å

PDB Description: crystal structure of c148 mgfp-cdna-1

PDB Compounds: (B:) C148 mGFP-cDNA-1

SCOPe Domain Sequences for d6uhnb_:

Sequence; same for both SEQRES and ATOM records:

>d6uhnb_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfilttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynchnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d6uhnb_:

• d6uhnb_ first appeared in SCOPe 2.07