Lineage for d1hhga2 (1hhg A:1-181)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131843Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 131852Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)
  8. 131888Domain d1hhga2: 1hhg A:1-181 [38247]
    Other proteins in same PDB: d1hhga1, d1hhgb1, d1hhgd1, d1hhge1

Details for d1hhga2

PDB Entry: 1hhg (more details), 2.6 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhga2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hhga2:

Click to download the PDB-style file with coordinates for d1hhga2.
(The format of our PDB-style files is described here.)

Timeline for d1hhga2: