Lineage for d1qr1d2 (1qr1 D:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600266Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (36 PDB entries)
  8. 600299Domain d1qr1d2: 1qr1 D:1-181 [38246]
    Other proteins in same PDB: d1qr1a1, d1qr1b_, d1qr1d1, d1qr1e_

Details for d1qr1d2

PDB Entry: 1qr1 (more details), 2.4 Å

PDB Description: poor binding of a her-2/neu epitope (gp2) to hla-a2.1 is due to a lack of interactions in the center of the peptide

SCOP Domain Sequences for d1qr1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr1d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1qr1d2:

Click to download the PDB-style file with coordinates for d1qr1d2.
(The format of our PDB-style files is described here.)

Timeline for d1qr1d2: