Lineage for d6taea_ (6tae A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719960Protein Ascorbate peroxidase [48123] (3 species)
  7. 2719966Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2719978Domain d6taea_: 6tae A: [382458]
    automated match to d1oaga_
    complexed with dod, hem, so4

Details for d6taea_

PDB Entry: 6tae (more details), 1.9 Å

PDB Description: neutron structure of ferric ascorbate peroxidase
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d6taea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6taea_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d6taea_:

Click to download the PDB-style file with coordinates for d6taea_.
(The format of our PDB-style files is described here.)

Timeline for d6taea_: