Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Ascorbate peroxidase [48123] (3 species) |
Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries) Uniprot Q43758 |
Domain d6taea_: 6tae A: [382458] automated match to d1oaga_ complexed with dod, hem, so4 |
PDB Entry: 6tae (more details), 1.9 Å
SCOPe Domain Sequences for d6taea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6taea_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfada
Timeline for d6taea_: