SCOPe 2.07: Domain d6uhma_: 6uhm A:

Lineage for d6uhma_ (6uhm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries)

8. Domain d6uhma_: 6uhm A: [382440]
   automated match to d3srya_

Details for d6uhma_

PDB Entry: 6uhm, 2.1 Å

PDB Description: crystal structure of a physical mixture of c148 mgfp and scdna-1

PDB Compounds: (A:) C148 mGFP

SCOPe Domain Sequences for d6uhma_:

Sequence; same for both SEQRES and ATOM records:

>d6uhma_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
dkmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfilttgklpvpw
ptlvttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegd
tlvnrielkgidfkedgnilghkleynynchnvyimadkqkngikvnfkirhniedgsvq
ladhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d6uhma_:

• d6uhma_ is new in SCOPe 2.07-stable
  
• d6uhma_ appears in the current release, SCOPe 2.08