Lineage for d1hhid2 (1hhi D:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31188Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (20 PDB entries)
  8. 31207Domain d1hhid2: 1hhi D:1-181 [38244]
    Other proteins in same PDB: d1hhia1, d1hhib1, d1hhid1, d1hhie1

Details for d1hhid2

PDB Entry: 1hhi (more details), 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhid2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hhid2:

Click to download the PDB-style file with coordinates for d1hhid2.
(The format of our PDB-style files is described here.)

Timeline for d1hhid2: