Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
Protein automated matches [190175] (10 species) not a true protein |
Species Microseira wollei [TaxId:467598] [382425] (1 PDB entry) |
Domain d6u1ra_: 6u1r A: [382429] automated match to d5wpia_ complexed with fmt |
PDB Entry: 6u1r (more details), 1.79 Å
SCOPe Domain Sequences for d6u1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u1ra_ d.126.1.0 (A:) automated matches {Microseira wollei [TaxId: 467598]} cpvnsynewdaleevivgsvegamlpalepinkwtfpleelasaqkvlfetggipyppem iavahkelnefihileaegvkvrrvkpvdffasfstpawqvrsgfcaanprdvflvigne iieapmadrnryfeawayrdllkeyfqagakwtaapkpqlfdaqydfnfqfpqtgepsrf vvtefeptfdaadfvrcgrdifgqkshvtnslgiewlqrhledeyrihiiesqcpealhi dttlmplapgkilvnpefvdvnklpkilkswdilvapypnhipqnqlrlvsewaglnvlm ldeervivekkqepmikalkdwgfkpivcsfesyypflgsfhcatldvrrrgtlqsyf
Timeline for d6u1ra_: