Lineage for d6u1ra_ (6u1r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974447Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2974448Protein automated matches [190175] (10 species)
    not a true protein
  7. 2974523Species Microseira wollei [TaxId:467598] [382425] (1 PDB entry)
  8. 2974524Domain d6u1ra_: 6u1r A: [382429]
    automated match to d5wpia_
    complexed with fmt

Details for d6u1ra_

PDB Entry: 6u1r (more details), 1.79 Å

PDB Description: sxtg an amidinotransferase from the microseira wollei in saxitoxin biosynthetic pathway
PDB Compounds: (A:) SxtG

SCOPe Domain Sequences for d6u1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u1ra_ d.126.1.0 (A:) automated matches {Microseira wollei [TaxId: 467598]}
cpvnsynewdaleevivgsvegamlpalepinkwtfpleelasaqkvlfetggipyppem
iavahkelnefihileaegvkvrrvkpvdffasfstpawqvrsgfcaanprdvflvigne
iieapmadrnryfeawayrdllkeyfqagakwtaapkpqlfdaqydfnfqfpqtgepsrf
vvtefeptfdaadfvrcgrdifgqkshvtnslgiewlqrhledeyrihiiesqcpealhi
dttlmplapgkilvnpefvdvnklpkilkswdilvapypnhipqnqlrlvsewaglnvlm
ldeervivekkqepmikalkdwgfkpivcsfesyypflgsfhcatldvrrrgtlqsyf

SCOPe Domain Coordinates for d6u1ra_:

Click to download the PDB-style file with coordinates for d6u1ra_.
(The format of our PDB-style files is described here.)

Timeline for d6u1ra_: