SCOPe 2.01: Domain d1hhjd2: 1hhj D:1-181

Lineage for d1hhjd2 (1hhj D:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
   Uniprot P01892 25-298

8. Domain d1hhjd2: 1hhj D:1-181 [38242]
   Other proteins in same PDB: d1hhja1, d1hhjb_, d1hhjd1, d1hhje_

Details for d1hhjd2

PDB Entry: 1hhj, 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

PDB Compounds: (D:) class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOPe Domain Sequences for d1hhjd2:

Sequence; same for both SEQRES and ATOM records:

>d1hhjd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1hhjd2:

• d1hhjd2 first appeared (with stable ids) in SCOP 1.55
  
• d1hhjd2 appears in SCOP 1.75
  
• d1hhjd2 appears in SCOPe 2.02
  
• d1hhjd2 appears in the current release, SCOPe 2.08