Lineage for d1hhjd2 (1hhj D:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856344Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 856444Domain d1hhjd2: 1hhj D:1-181 [38242]
    Other proteins in same PDB: d1hhja1, d1hhjb_, d1hhjd1, d1hhje_

Details for d1hhjd2

PDB Entry: 1hhj (more details), 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2
PDB Compounds: (D:) class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOP Domain Sequences for d1hhjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhjd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1hhjd2:

Click to download the PDB-style file with coordinates for d1hhjd2.
(The format of our PDB-style files is described here.)

Timeline for d1hhjd2: