| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins) |
| Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries) |
| Domain d1hhjd2: 1hhj D:1-181 [38242] Other proteins in same PDB: d1hhja1, d1hhjb1, d1hhjd1, d1hhje1 |
PDB Entry: 1hhj (more details), 2.5 Å
SCOP Domain Sequences for d1hhjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhjd2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d1hhjd2:
View in 3DDomains from other chains: (mouse over for more information) d1hhja1, d1hhja2, d1hhjb1, d1hhje1 |