Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (33 PDB entries) |
Domain d1hhja2: 1hhj A:1-181 [38241] Other proteins in same PDB: d1hhja1, d1hhjb_, d1hhjd1, d1hhje_ |
PDB Entry: 1hhj (more details), 2.5 Å
SCOP Domain Sequences for d1hhja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhja2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1hhja2:
View in 3D Domains from other chains: (mouse over for more information) d1hhjb_, d1hhjd1, d1hhjd2, d1hhje_ |