Lineage for d1b0gd2 (1b0g D:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198044Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 1198140Domain d1b0gd2: 1b0g D:1-181 [38240]
    Other proteins in same PDB: d1b0ga1, d1b0gb_, d1b0gd1, d1b0ge_

Details for d1b0gd2

PDB Entry: 1b0g (more details), 2.5 Å

PDB Description: class i histocompatibility antigen (hla-a2.1)/beta 2-microglobulin/peptide p1049 complex
PDB Compounds: (D:) class I histocompatibility antigen

SCOPe Domain Sequences for d1b0gd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0gd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1b0gd2:

Click to download the PDB-style file with coordinates for d1b0gd2.
(The format of our PDB-style files is described here.)

Timeline for d1b0gd2: