Lineage for d1qrna2 (1qrn A:1-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78670Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (24 PDB entries)
  8. 78693Domain d1qrna2: 1qrn A:1-181 [38238]
    Other proteins in same PDB: d1qrna1, d1qrnb1, d1qrnd1, d1qrnd2, d1qrne1, d1qrne2

Details for d1qrna2

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrna2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1qrna2:

Click to download the PDB-style file with coordinates for d1qrna2.
(The format of our PDB-style files is described here.)

Timeline for d1qrna2: