Lineage for d1qrna2 (1qrn A:1-181)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species) Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (24 PDB entries) 
Domain d1qrna2: 1qrn A:1-181 [38238]
Other proteins in same PDB: d1qrna1, d1qrnb1, d1qrnd1, d1qrnd2, d1qrne1, d1qrne2
Details for d1qrna2
PDB Entry: 1qrn (more details), 2.8 Å
PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a
SCOP Domain Sequences for d1qrna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrna2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
SCOP Domain Coordinates for d1qrna2:
Click to download the PDB-style file with coordinates for d1qrna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qrna2:
View in 3D
