Lineage for d1ao7a2 (1ao7 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544929Domain d1ao7a2: 1ao7 A:1-181 [38237]
    Other proteins in same PDB: d1ao7a1, d1ao7b2, d1ao7b3, d1ao7d_, d1ao7e1, d1ao7e2
    complexed with emc

Details for d1ao7a2

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201
PDB Compounds: (A:) hla-a 0201

SCOPe Domain Sequences for d1ao7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao7a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1ao7a2:

Click to download the PDB-style file with coordinates for d1ao7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ao7a2: