SCOPe 2.08: Domain d1ao7a2: 1ao7 A:1-181

Lineage for d1ao7a2 (1ao7 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d1ao7a2: 1ao7 A:1-181 [38237]
   Other proteins in same PDB: d1ao7a1, d1ao7b2, d1ao7b3, d1ao7d_, d1ao7e1, d1ao7e2
   complexed with emc

Details for d1ao7a2

PDB Entry: 1ao7, 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

PDB Compounds: (A:) hla-a 0201

SCOPe Domain Sequences for d1ao7a2:

Sequence; same for both SEQRES and ATOM records:

>d1ao7a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1ao7a2:

• d1ao7a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ao7a2 appears in SCOPe 2.07