SCOPe 2.08: Domain d1hhka2: 1hhk A:1-181

Lineage for d1hhka2 (1hhk A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d1hhka2: 1hhk A:1-181 [38234]
   Other proteins in same PDB: d1hhka1, d1hhkb2, d1hhkb3, d1hhkd1, d1hhke2, d1hhke3

Details for d1hhka2

PDB Entry: 1hhk, 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

PDB Compounds: (A:) class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOPe Domain Sequences for d1hhka2:

Sequence; same for both SEQRES and ATOM records:

>d1hhka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1hhka2:

• d1hhka2 first appeared (with stable ids) in SCOP 1.55
  
• d1hhka2 appears in SCOPe 2.07