Lineage for d1akja2 (1akj A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937798Domain d1akja2: 1akj A:1-181 [38233]
    Other proteins in same PDB: d1akja1, d1akjb_, d1akjd_, d1akje_

Details for d1akja2

PDB Entry: 1akj (more details), 2.65 Å

PDB Description: complex of the human mhc class i glycoprotein hla-a2 and the t cell coreceptor cd8
PDB Compounds: (A:) MHC class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOPe Domain Sequences for d1akja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akja2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1akja2:

Click to download the PDB-style file with coordinates for d1akja2.
(The format of our PDB-style files is described here.)

Timeline for d1akja2: