Lineage for d6oa6a2 (6oa6 A:161-271)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712108Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2712110Domain d6oa6a2: 6oa6 A:161-271 [382325]
    Other proteins in same PDB: d6oa6a3
    automated match to d5a36b2
    complexed with gol

Details for d6oa6a2

PDB Entry: 6oa6 (more details), 1.37 Å

PDB Description: crystal structure of the actin-binding domain of human alpha-actinin-4
PDB Compounds: (A:) Alpha-actinin-4

SCOPe Domain Sequences for d6oa6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oa6a2 a.40.1.0 (A:161-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddp
vtnlnnafevaekyldipkmldaedivntarpdekaimtyvssfyhafsga

SCOPe Domain Coordinates for d6oa6a2:

Click to download the PDB-style file with coordinates for d6oa6a2.
(The format of our PDB-style files is described here.)

Timeline for d6oa6a2: