Class a: All alpha proteins [46456] (290 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
Domain d6oa6a2: 6oa6 A:161-271 [382325] Other proteins in same PDB: d6oa6a3 automated match to d5a36b2 complexed with gol |
PDB Entry: 6oa6 (more details), 1.37 Å
SCOPe Domain Sequences for d6oa6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oa6a2 a.40.1.0 (A:161-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddp vtnlnnafevaekyldipkmldaedivntarpdekaimtyvssfyhafsga
Timeline for d6oa6a2: