Lineage for d6lvsc_ (6lvs C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534498Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2534499Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species)
  7. 2534500Species Human (Homo sapiens) [TaxId:9606] [142861] (7 PDB entries)
    Uniprot P54578 100-482
  8. 2534511Domain d6lvsc_: 6lvs C: [382301]
    automated match to d2ayna1
    complexed with bme, edo, fmt, gol, na; mutant

Details for d6lvsc_

PDB Entry: 6lvs (more details), 2.73 Å

PDB Description: usp14 catalytic domain mutant c114s
PDB Compounds: (C:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d6lvsc_:

Sequence, based on SEQRES records: (download)

>d6lvsc_ d.3.1.9 (C:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
amelpcgltnlgntsymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdl
fdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaie
ddssaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylft
glklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvk
fplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevkyepfsfad
digsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtpedilrlsg
ggdwhiayvllygprr

Sequence, based on observed residues (ATOM records): (download)

>d6lvsc_ d.3.1.9 (C:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
amelpcgltnlgntsymnatvqcirsvpelkdalkryagalmasaqyitaalrdlfdsmd
ktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieslidq
ffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptl
qrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelqe
kmvsfrskfyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfd
ddkvsivtpedilrlsgggdwhiayvllygprr

SCOPe Domain Coordinates for d6lvsc_:

Click to download the PDB-style file with coordinates for d6lvsc_.
(The format of our PDB-style files is described here.)

Timeline for d6lvsc_: