Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (4 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries) |
Domain d6m0je_: 6m0j E: [382293] Other proteins in same PDB: d6m0ja_ automated match to d2dd8s1 complexed with nag, zn |
PDB Entry: 6m0j (more details), 2.45 Å
SCOPe Domain Sequences for d6m0je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m0je_ d.318.1.1 (E:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf tnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyl yrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvv lsfellhapatvcg
Timeline for d6m0je_: