SCOPe 2.08: Domain d6hgal2: 6hga L:113-219

Lineage for d6hgal2 (6hga L:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6hgal2: 6hga L:113-219 [382281]
   Other proteins in same PDB: d6hgah_, d6hgal1
   automated match to d1t66c2
   complexed with nag

Details for d6hgal2

PDB Entry: 6hga, 2.6 Å

PDB Description: crystal structure of the human il-17rc d2-d3-d4 domains in complex with an anti-app tag fab

PDB Compounds: (L:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgal2:

Sequence; same for both SEQRES and ATOM records:

>d6hgal2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d6hgal2:

• d6hgal2 first appeared in SCOPe 2.07