Lineage for d6hgal1 (6hga L:1-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (22 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 3082218Domain d6hgal1: 6hga L:1-112 [382280]
    Other proteins in same PDB: d6hgal2
    automated match to d1t66c1
    complexed with nag

Details for d6hgal1

PDB Entry: 6hga (more details), 2.6 Å

PDB Description: crystal structure of the human il-17rc d2-d3-d4 domains in complex with an anti-app tag fab
PDB Compounds: (L:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgal1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqnthvpltfgagtklelk

SCOPe Domain Coordinates for d6hgal1:

Click to download the PDB-style file with coordinates for d6hgal1.
(The format of our PDB-style files is described here.)

Timeline for d6hgal1:

  • d6hgal1 is new in SCOPe 2.07-stable