SCOPe 2.08: Domain d6hgal1: 6hga L:1-112

Lineage for d6hgal1 (6hga L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6hgal1: 6hga L:1-112 [382280]
   Other proteins in same PDB: d6hgal2
   automated match to d1t66c1
   complexed with nag

Details for d6hgal1

PDB Entry: 6hga, 2.6 Å

PDB Description: crystal structure of the human il-17rc d2-d3-d4 domains in complex with an anti-app tag fab

PDB Compounds: (L:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgal1:

Sequence; same for both SEQRES and ATOM records:

>d6hgal1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqnthvpltfgagtklelk

Timeline for d6hgal1:

• d6hgal1 first appeared in SCOPe 2.07