![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries) |
![]() | Domain d2clra2: 2clr A:1-181 [38228] Other proteins in same PDB: d2clra1, d2clrb_, d2clrd1, d2clre_ |
PDB Entry: 2clr (more details), 2 Å
SCOP Domain Sequences for d2clra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2clra2:
![]() Domains from other chains: (mouse over for more information) d2clrb_, d2clrd1, d2clrd2, d2clre_ |