SCOPe 2.06: Domain d1duzd2: 1duz D:1-181

Lineage for d1duzd2 (1duz D:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
   Uniprot P01892 25-298

8. Domain d1duzd2: 1duz D:1-181 [38225]
   Other proteins in same PDB: d1duza1, d1duzb_, d1duzd1, d1duze_

Details for d1duzd2

PDB Entry: 1duz, 1.8 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) in complex with a nonameric peptide from htlv-1 tax protein

PDB Compounds: (D:) hla-a*0201

SCOPe Domain Sequences for d1duzd2:

Sequence; same for both SEQRES and ATOM records:

>d1duzd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1duzd2:

• d1duzd2 first appeared (with stable ids) in SCOP 1.55
  
• d1duzd2 appears in SCOPe 2.05
  
• d1duzd2 appears in SCOPe 2.07
  
• d1duzd2 appears in the current release, SCOPe 2.08