SCOPe 2.03: Domain d1f3je2: 1f3j E:4-93

Lineage for d1f3je2 (1f3j E:4-93)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (4 PDB entries)

8. Domain d1f3je2: 1f3j E:4-93 [38222]
   Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb1, d1f3jd1, d1f3jd2, d1f3je1
   complexed with nag

Details for d1f3je2

PDB Entry: 1f3j, 3.1 Å

PDB Description: histocompatibility antigen i-ag7

PDB Compounds: (E:) MHC class II nod

SCOPe Domain Sequences for d1f3je2:

Sequence; same for both SEQRES and ATOM records:

>d1f3je2 d.19.1.1 (E:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
qylertraeldtacrhnyeetevptslrr

Timeline for d1f3je2:

• d1f3je2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3je2 appears in SCOPe 2.02
  
• d1f3je2 appears in SCOPe 2.04
  
• d1f3je2 appears in the current release, SCOPe 2.08