![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
![]() | Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species) |
![]() | Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [54467] (2 PDB entries) |
![]() | Domain d1f3jd2: 1f3j D:1-82 [38221] Other proteins in same PDB: d1f3ja1, d1f3jb1, d1f3jd1, d1f3je1 |
PDB Entry: 1f3j (more details), 3.1 Å
SCOP Domain Sequences for d1f3jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3jd2 d.19.1.1 (D:1-82) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)} ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg lqniaaekhnlgiltkrsnftpa
Timeline for d1f3jd2: