Lineage for d1f3jd2 (1f3j D:1-82)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31338Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [54467] (2 PDB entries)
  8. 31343Domain d1f3jd2: 1f3j D:1-82 [38221]
    Other proteins in same PDB: d1f3ja1, d1f3jb1, d1f3jd1, d1f3je1

Details for d1f3jd2

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3jd2 d.19.1.1 (D:1-82) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpa

SCOP Domain Coordinates for d1f3jd2:

Click to download the PDB-style file with coordinates for d1f3jd2.
(The format of our PDB-style files is described here.)

Timeline for d1f3jd2: