Lineage for d1f3jb2 (1f3j B:4-93)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938447Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (4 PDB entries)
  8. 2938451Domain d1f3jb2: 1f3j B:4-93 [38220]
    Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb1, d1f3jd1, d1f3jd2, d1f3je1
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1f3jb2

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (B:) MHC class II nod

SCOPe Domain Sequences for d1f3jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3jb2 d.19.1.1 (B:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
qylertraeldtacrhnyeetevptslrr

SCOPe Domain Coordinates for d1f3jb2:

Click to download the PDB-style file with coordinates for d1f3jb2.
(The format of our PDB-style files is described here.)

Timeline for d1f3jb2: