SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f3jb2 (1f3j B:4-93)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163749Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2163825Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (4 PDB entries)
  8. 2163829Domain d1f3jb2: 1f3j B:4-93 [38220]
    Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb1, d1f3jd1, d1f3jd2, d1f3je1
    complexed with nag

Details for d1f3jb2

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (B:) MHC class II nod

SCOPe Domain Sequences for d1f3jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3jb2 d.19.1.1 (B:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
qylertraeldtacrhnyeetevptslrr

SCOPe Domain Coordinates for d1f3jb2:

Click to download the PDB-style file with coordinates for d1f3jb2.
(The format of our PDB-style files is described here.)

Timeline for d1f3jb2: