Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (4 PDB entries) |
Domain d1f3jb2: 1f3j B:4-93 [38220] Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb1, d1f3jd1, d1f3jd2, d1f3je1 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1f3j (more details), 3.1 Å
SCOPe Domain Sequences for d1f3jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3jb2 d.19.1.1 (B:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]} erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk qylertraeldtacrhnyeetevptslrr
Timeline for d1f3jb2: