Lineage for d6sdvb_ (6sdv B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949437Protein automated matches [254689] (2 species)
    not a true protein
  7. 2949438Species Desulfovibrio vulgaris [TaxId:882] [382175] (2 PDB entries)
  8. 2949439Domain d6sdvb_: 6sdv B: [382176]
    automated match to d1h0hb_
    complexed with gol, h2s, mgd, no3, peg, sf4, w

Details for d6sdvb_

PDB Entry: 6sdv (more details), 1.9 Å

PDB Description: w-formate dehydrogenase from desulfovibrio vulgaris - formate reduced form
PDB Compounds: (B:) Formate dehydrogenase, beta subunit, putative

SCOPe Domain Sequences for d6sdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sdvb_ d.58.1.5 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gkmffvdlsrctacrgcqiackqwknlpaeetrntgshqnppdlsyvtlktvrfteksrk
gpgidwlffpeqcrhcveppckgqadvdlegavvkdettgavlfteltakvdgesvrsac
pydipridpvtkrlskcdmcndrvqngllpacvktcptgtmnfgdeqemlalaekrlaev
kktypgavlgdpndvrvvylftrdpkdfyehava

SCOPe Domain Coordinates for d6sdvb_:

Click to download the PDB-style file with coordinates for d6sdvb_.
(The format of our PDB-style files is described here.)

Timeline for d6sdvb_: