Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [254689] (2 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:882] [382175] (2 PDB entries) |
Domain d6sdvb_: 6sdv B: [382176] automated match to d1h0hb_ complexed with gol, h2s, mgd, no3, peg, sf4, w |
PDB Entry: 6sdv (more details), 1.9 Å
SCOPe Domain Sequences for d6sdvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sdvb_ d.58.1.5 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 882]} gkmffvdlsrctacrgcqiackqwknlpaeetrntgshqnppdlsyvtlktvrfteksrk gpgidwlffpeqcrhcveppckgqadvdlegavvkdettgavlfteltakvdgesvrsac pydipridpvtkrlskcdmcndrvqngllpacvktcptgtmnfgdeqemlalaekrlaev kktypgavlgdpndvrvvylftrdpkdfyehava
Timeline for d6sdvb_: