Lineage for d1iaob2 (1iao B:6-93)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255493Species Mouse (Mus musculus), I-AD [TaxId:10090] [54466] (2 PDB entries)
  8. 255497Domain d1iaob2: 1iao B:6-93 [38216]
    Other proteins in same PDB: d1iaoa1, d1iaob1
    complexed with nag

Details for d1iaob2

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339

SCOP Domain Sequences for d1iaob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaob2 d.19.1.1 (B:6-93) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
hfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravtelgrpdaeywnsqp
eildrtraevdtacrhnyegpetstslr

SCOP Domain Coordinates for d1iaob2:

Click to download the PDB-style file with coordinates for d1iaob2.
(The format of our PDB-style files is described here.)

Timeline for d1iaob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaob1